{"product_id":"proteintech-21928-1-ap","title":"Proteintech, 21928-1-AP, CHRNG Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHRNG (21928-1-AP) by Proteintech is a Polyclonal antibody targeting CHRNG in WB, ELISA applications with reactivity to human samples\n21928-1-AP targets CHRNG in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAcetylcholine receptor subunit gamma is a protein that in humans is encoded by the CHRNG gene. The mammalian muscle-type acetylcholine receptor is a transmembrane pentameric glycoprotein with two alpha subunits, one beta, one delta, and one epsilon (in adult skeletal muscle) or gamma (in fetal and denervated muscle) subunit. This gene, which encodes the gamma subunit, is expressed prior to the thirty-third week of gestation in humans. The gamma subunit of the acetylcholine receptor plays a role in neuromuscular organogenesis and ligand binding and disruption of gamma subunit expression prevents the correct localization of the receptor in cell membranes. Mutations in this gene cause Escobar syndrome and a lethal form of multiple pterygium syndrome. Muscle-type acetylcholine receptor is the major antigen in the autoimmune disease myasthenia gravis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16505 Product name: Recombinant human CHRNG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 279-422 aa of BC111802 Sequence: LRSPHTHSMARGVRKVFLRLLPQLLRMHVRPLAPAAVQDTQSRLQNGSSGWSITTGEEVALCLPRSELLFQQWQRQGLVAAALEKLEKGPELGLSQFCGSLKQAAPAIQACVEACNLIACARHQQSHFDNGNEEWFLVGRVLDR Predict reactive species\nFull Name: cholinergic receptor, nicotinic, gamma\nCalculated Molecular Weight: 465 aa, 52 kDa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: BC111802\nGene Symbol: CHRNG\nGene ID (NCBI): 1146\nRRID: AB_3085678\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P07510\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886546112681,"sku":"21928-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21928-1-ap","provider":"Iright","version":"1.0","type":"link"}