{"product_id":"proteintech-21939-1-ap","title":"Proteintech, 21939-1-AP, CHRNA4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHRNA4 (21939-1-AP) by Proteintech is a Polyclonal antibody targeting CHRNA4 in WB, ELISA applications with reactivity to human, Mouse samples\n21939-1-AP targets CHRNA4 in WB, ELISA applications and shows reactivity with human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Neuro-2a cells, C6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThis gene encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, Mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16584 Product name: Recombinant human CHRNA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 334-573 aa of BC096290 Sequence: SPRTHTMPTWVRRVFLDIVPRLLLMKRPSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGPSCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEGGVRCRSRSIQYCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSVSPSATVKTRSTKAPPPHLPLSPALTRAVEGVQY Predict reactive species\nFull Name: cholinergic receptor, nicotinic, alpha 4\nCalculated Molecular Weight: 627 aa, 70 kDa\nObserved Molecular Weight: 69 kDa\nGenBank Accession Number: BC096290\nGene Symbol: CHRNA4\nGene ID (NCBI): 1137\nRRID: AB_3085680\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P43681\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886542639273,"sku":"21939-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21939-1-ap","provider":"Iright","version":"1.0","type":"link"}