{"product_id":"proteintech-21973-1-ap","title":"Proteintech, 21973-1-AP, GFRA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GFRA2 (21973-1-AP) by Proteintech is a Polyclonal antibody targeting GFRA2 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n21973-1-AP targets GFRA2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, mouse brain tissue,  L02 cells,  U-87 MG cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGFRA2, also named as GDNFRB, RETL2 and TRNR2, belongs to the GDNFR family. It is a receptor for neurturin. GFRA2 mediates the NRTN-induced autophosphorylation and activation of the RET receptor. It is a potent survival factor for central dopaminergic neurons, motor neurons, and several other populations of neurons in the central and peripheral nervous systems. The GDNF signal is mediated by a complex of the receptor tyrosine kinase RET and a glycosylphosphatidylinositol (GPI)-linked protein, GDNFRA. GFRA2 has three isoforms with MW 34-36 kDa, 39-41 kDa and 50-55 kDa. This antibody recognizes all the three isoforms.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16893 Product name: Recombinant human GFRA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 270-464 aa of BC041688 Sequence: DFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNSGPSRARPSAALTVLSVLMLKLAL Predict reactive species\nFull Name: GDNF family receptor alpha 2\nCalculated Molecular Weight: 464 aa, 52 kDa\nObserved Molecular Weight: 34-40 kDa, 50-55 kDa\nGenBank Accession Number: BC041688\nGene Symbol: GFRA2\nGene ID (NCBI): 2675\nRRID: AB_11124728\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00451\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869463105705,"sku":"21973-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21973-1-ap","provider":"Iright","version":"1.0","type":"link"}