{"product_id":"proteintech-21983-1-ap","title":"Proteintech, 21983-1-AP, TSPAN9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TSPAN9 (21983-1-AP) by Proteintech is a Polyclonal antibody targeting TSPAN9 in WB, IP, ELISA applications with reactivity to human,  mouse,  rat samples\n21983-1-AP targets TSPAN9 in WB, IP, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse peripheral blood leukocyte, mouse spleen tissue,  rat spleen tissue\nPositive IP detected in: mouse spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTSPAN9 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. TSPAN9 is relatively highly expressed in the megakaryocyte\/platelet lineage and has a role in regulating platelet function in concert with other platelet tetraspanins and their associated proteins. TSPAN9 has been identified as a glycoprotein (PMID: 18795891). This polyclonal antibody detects endogenous TSPAN9 at a band of 29-33 kDa, which is larger than the calculated molecular weight of TSPAN9 (27 kDa), probably due to glycosylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17048 Product name: Recombinant human TSPAN9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-239 aa of BC071881 Sequence: LLILFFVYMDKVNENAKKDLKEGLLLYHTENNVGLKNAWNIIQAEMRCCGVTDYTDWYPVLGENTVPDRCCMENSQGCGRNATTPLWRTGCYEKVKMWFDDNKHVLGTVGMCILIMQILGMAFSMTLFQHIHRTGKKYDA Predict reactive species\nFull Name: tetraspanin 9\nCalculated Molecular Weight: 239 aa, 27 kDa\nObserved Molecular Weight: 29-33 kDa\nGenBank Accession Number: BC071881\nGene Symbol: TSPAN9\nGene ID (NCBI): 10867\nRRID: AB_2878960\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75954\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869506064553,"sku":"21983-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21983-1-ap","provider":"Iright","version":"1.0","type":"link"}