{"product_id":"proteintech-22013-1-ap","title":"Proteintech, 22013-1-AP, SLC26A5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC26A5 (22013-1-AP) by Proteintech is a Polyclonal antibody targeting SLC26A5 in WB, ELISA applications with reactivity to human, mouse, rat samples\n22013-1-AP targets SLC26A5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse heart tissue,  rat brain tissue,  rat heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC26A5 (Prestin) is a protein that is housed in abundance within the lateral membrane of outer hair cells (OHC) in the organ of Corti. The protein imparts robust electromechanical activity to the cell that is unlike any other form of cellular motility, notably associated with a voltage-dependent, bell-shaped nonlinear capacitance (NLC) that reports on conformational changes in the protein (PMID: 32061780). SLC26A5 is responsible for acute sensitivity and frequency selectivity in the vertebrate auditory system (PMID: 34294052).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16631 Product name: Recombinant human SLC26A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-86 aa of BC100832 Sequence: MDHAEENEILAATQRYYVERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKKIRNIIYMFLPITKWLPAYKFKEYVLGDLVS Predict reactive species\nFull Name: solute carrier family 26, member 5 (prestin)\nCalculated Molecular Weight: 744 aa, 81 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC100832\nGene Symbol: SLC26A5\nGene ID (NCBI): 375611\nRRID: AB_3669384\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P58743\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887805419689,"sku":"22013-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22013-1-ap","provider":"Iright","version":"1.0","type":"link"}