{"product_id":"proteintech-22023-1-ap","title":"Proteintech, 22023-1-AP, NFATC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NFATC2 (22023-1-AP) by Proteintech is a Polyclonal antibody targeting NFATC2 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples\n22023-1-AP targets NFATC2 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human breast cancer tissue, human colon cancer tissue,  human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U-251 cells\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNuclear factor of activated T-cells, cytoplasmic 2 (NFATC2), also named NFAT1, or NFATP, is a 925 amino acid protein, which is expressed in thymus, spleen, heart, testis, brain, placenta, muscle and pancreas. Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription. NFATC2 plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2, IL-3, IL-4, TNF-alpha or GM-CSF. NFATC2 promotes invasive migration through the activation of GPC6 expression and WNT5A signaling pathway. The calculated molecular weight of NFATC2 is about 97-100 kDa, but the modified NFATC2 protein is about 135 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16849 Product name: Recombinant human NFATC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC136418 Sequence: MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGSAV Predict reactive species\nFull Name: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2\nCalculated Molecular Weight: 925 aa, 100 kDa\nObserved Molecular Weight: 135 kDa\nGenBank Accession Number: BC136418\nGene Symbol: NFATC2\nGene ID (NCBI): 4773\nRRID: AB_2878973\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13469\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868869644457,"sku":"22023-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22023-1-ap","provider":"Iright","version":"1.0","type":"link"}