{"product_id":"proteintech-22068-1-ap","title":"Proteintech, 22068-1-AP, UNC5A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UNC5A (22068-1-AP) by Proteintech is a Polyclonal antibody targeting UNC5A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n22068-1-AP targets UNC5A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, HeLa cells,  PC-3 cells\nPositive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUNC5A, also named as KIAA1976 and UNC5H1, belongs to the unc-5 family. It is a receptor for netrin required for axon guidance. It mediates axon repulsion of neuronal growth cones in the developing nervous system upon ligand binding. Axon repulsion in growth cones may be caused by its association with DCC, which may trigger signaling for repulsion. It also acts as a dependence receptor required for apoptosis induction when not associated with the netrin ligand.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17155 Product name: Recombinant human UNC5A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 226-504 aa of BC157824 Sequence: IVARRRSASAAVIVYVDGSWSPWSKWSACGLDCTHWRSRECSDPAPRNGGEECQGTDLDTRNCTSDLCVHTASGPEDVALYVGLIAVAVCLVLLLLVLILVYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTTTYQGSLCPRQDGPSPKFQLTNGHLLSPLGGGRHTLHHSSPTSEAEEFVSRLSTQNYFRSLPRGTSNMTYGTFNFLGGRLMIPNTGISLLIPPDAIPRGKIYEIYLTLHKPEDVRLPLAGCQTLLSPIVS Predict reactive species\nFull Name: unc-5 homolog A (C. elegans)\nCalculated Molecular Weight: 842 aa, 93 kDa\nObserved Molecular Weight: 88-100 kDa\nGenBank Accession Number: BC157824\nGene Symbol: UNC5A\nGene ID (NCBI): 90249\nRRID: AB_11182161\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6ZN44\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869439348905,"sku":"22068-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22068-1-ap","provider":"Iright","version":"1.0","type":"link"}