{"product_id":"proteintech-22090-1-ap","title":"Proteintech, 22090-1-AP, TXLNB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TXLNB (22090-1-AP) by Proteintech is a Polyclonal antibody targeting TXLNB in WB, ELISA applications with reactivity to human, mouse samples\n22090-1-AP targets TXLNB in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human heart tissue, mouse heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTXLNB (Taxilin beta, gliding protein beta) is a protein enriched predominantly in cardiomyocytes and belongs to the centrosome articulating protein family. It is localized in the perinuclear region of the centrosome and is closely associated with the microtubule organizing center (MTOC) and the ubiquitin-proteasome system (UPS). TXLNB plays an important role in protein homeostasis in cardiomyocytes, affecting intracellular protein degradation and quality control by regulating the interactions between centrosomes and proteasomes. TXLNB was found to have a key role in cardiomyocyte hypertrophy and cardiac proteotoxicity, and its overexpression enhances proteasome activity and reduces the accumulation of ubiquitylated proteins, whereas knockdown leads to proteasome insufficiency and a decline in cardiac function with age. In addition, TXLNB may be involved in the dynamic regulation of the cytoskeleton and microtubules.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17295 Product name: Recombinant human TXLNB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 335-684 aa of BC115383 Sequence: LLNQAAEWKLQAKMLKEQETVLQAQLTLYSGRFEEFQSTLTKSNEVFATFKQEMDKTTKKMKKLEKDTATWKARFENCNKALLDMIEEKALRAKEYECFVMKIGRLENLCRALQEERNELHKKIRDAEISEKDDQSQHNSDEEPESNVSVDQEIDAEEVNSVQTAVKNLATAFMIIHHPESTPHQSKETQPEIGSSQESADAALKEPEQPPLIPSRDSESPLPPLTPQAEAEGGSDAEPPSKASNSPAGLGAETQCEGLPVGAQADQPSWKPEAEASGQAPQAPTEASLQKMEADVPAPACAAEEHVAAMVPACEPSRQPPRAAAEELPVGASAGPQPRNVADTNLEGVD Predict reactive species\nFull Name: taxilin beta\nCalculated Molecular Weight: 684 aa, 77 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: BC115383\nGene Symbol: TXLNB\nGene ID (NCBI): 167838\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N3L3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887911817385,"sku":"22090-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22090-1-ap","provider":"Iright","version":"1.0","type":"link"}