{"product_id":"proteintech-22106-1-ap","title":"Proteintech, 22106-1-AP, FAM167A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM167A (22106-1-AP) by Proteintech is a Polyclonal antibody targeting FAM167A in WB, ELISA applications with reactivity to human samples\n22106-1-AP targets FAM167A in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-87 MG cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFamily with sequence similarity 167, member A (FAM167A) has ubiquitously low expression in all tissues types throughout the body. In mouse it has a higher expression in the skin, B-cells, and spleen, but the same low expression in all other cell types. It's reported that FAM167A acts as an essential factor for BCR-ABL-independent TKI resistance in CML by activating the noncanonical NF-κB pathway.(PMID: 35241148)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17336 Product name: Recombinant human FAM167A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 48-214 aa of BC104041 Sequence: EWQARLEEQTWPFPRPAAEPQASLEEGERGGQEPLLPLREAGQHPPSARSASQGARPLSTGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMRLRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFSLC Predict reactive species\nFull Name: family with sequence similarity 167, member A\nCalculated Molecular Weight: 214 aa, 24 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC104041\nGene Symbol: FAM167A\nGene ID (NCBI): 83648\nRRID: AB_3669387\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96KS9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887631716521,"sku":"22106-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22106-1-ap","provider":"Iright","version":"1.0","type":"link"}