{"product_id":"proteintech-22142-1-ap","title":"Proteintech, 22142-1-AP, RCC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RCC1 (22142-1-AP) by Proteintech is a Polyclonal antibody targeting RCC1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, monkey samples\n22142-1-AP targets RCC1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HEK-293 cells,  NIH\/3T3 cells,  HepG2 cells,  Jurkat cells,  SH-SY5Y cells,  COS-7 cells,  HeLa cells,  MCF-7 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human stomach tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:750-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCHC1, also named as RCC1, promotes the exchange of ran-bound gdp by gtp. It is involved in the regulation of onset of chromosome condensation in the S-phase. Phosphorylation of RCC1 on serines located in or near its nuclear localization signal activates RCC1 to generate RanGTP on mitotic chromosomes, which is required for spindle assembly and chromosome segregation. This antibody is a rabbit polyclonal antibody raised against residues near the C terminus of human RCC1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, monkey\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17569 Product name: Recombinant human RCC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 72-421 aa of BC010067 Sequence: AEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS Predict reactive species\nFull Name: regulator of chromosome condensation 1\nCalculated Molecular Weight: 421 aa, 45 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC010067\nGene Symbol: RCC1\nGene ID (NCBI): 1104\nRRID: AB_11183045\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P18754\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868944715945,"sku":"22142-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22142-1-ap","provider":"Iright","version":"1.0","type":"link"}