{"product_id":"proteintech-22144-1-ap","title":"Proteintech, 22144-1-AP, LY6E Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LY6E (22144-1-AP) by Proteintech is a Polyclonal antibody targeting LY6E in WB, ELISA applications with reactivity to human, mouse, rat samples\n22144-1-AP targets LY6E in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, rat kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe predicted MW of LY6E is 13 kDa. Catalog#22144-1-AP recognises two band of 13 kDa and 18 kDa, and the additional 18 kDa band may be due to glycosylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17573 Product name: Recombinant human LY6E protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-101 aa of BC119708 Sequence: LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS Predict reactive species\nFull Name: lymphocyte antigen 6 complex, locus E\nCalculated Molecular Weight: 131 aa, 14 kDa\nObserved Molecular Weight: 12-16 kDa\nGenBank Accession Number: BC119708\nGene Symbol: LY6E\nGene ID (NCBI): 4061\nRRID: AB_2879007\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16553\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869415002281,"sku":"22144-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22144-1-ap","provider":"Iright","version":"1.0","type":"link"}