{"product_id":"proteintech-22150-1-ap","title":"Proteintech, 22150-1-AP, PYCR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PYCR1 (22150-1-AP) by Proteintech is a Polyclonal antibody targeting PYCR1 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n22150-1-AP targets PYCR1 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  COLO 320 cells\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPYCR1,also named as P5CR1, belongs to the pyrroline-5-carboxylate reductase family. It is a housekeeping enzyme that catalyzes the last step in proline biosynthesis. PYCR1 can utilize both NAD and NADP, but has higher affinity for NAD. It is involved in the cellular response to oxidative stress. Mutation in PYCR1 will cause ARCL type II(ARCL2B ). Some mutation will cause DeBarsy syndrome (DBS) which is characterized by progeroid features, ophthalmological abnormalities, intrauterine growth retardation, and cutis laxa. The MW of PYCR1 is about 33-35kd. This antibody may have cross reaction to PYCR2 due to the high homology.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17745 Product name: Recombinant human PYCR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-148 aa of BC022244 Sequence: ALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQVEDGRL Predict reactive species\nFull Name: pyrroline-5-carboxylate reductase 1\nCalculated Molecular Weight: 319 aa, 33 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC022244\nGene Symbol: PYCR1\nGene ID (NCBI): 5831\nRRID: AB_11182280\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P32322\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869747105961,"sku":"22150-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22150-1-ap","provider":"Iright","version":"1.0","type":"link"}