{"product_id":"proteintech-22216-1-ap","title":"Proteintech, 22216-1-AP, ADAM19 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADAM19 (22216-1-AP) by Proteintech is a Polyclonal antibody targeting ADAM19 in WB, ELISA applications with reactivity to human, mouse, rat samples\n22216-1-AP targets ADAM19 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMeltrinβ(ADAM19) is a metalloprotease-disintegrin expressed in the peripheral nervous system and other organs during embryogenesis. Its specific patterns of expression during embryogenesis suggest that it is involved in the development of the peripheral nervous system, skeletal muscle, bone and heart tissue(PMID:12482604). It participates in the proteolytic processing of beta-type neuregulin isoforms which are involved in neurogenesis and synaptogenesis, suggesting a regulatory role in glial cell.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17544 Product name: Recombinant human ADAM19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 291-471 aa of BC024214 Sequence: YYCCRQNNKLGQLKPSALPSKLRQQFSCPFRVSQNSGTGHANPTFKLQTPQGKRKVINTPEILRKPSQPPPRPPPDYLRGGSPPAPLPAHLSRAARNSPGPGSQIERTESSRRPPPSRPIPPAPNCIVSQDFSRPRPPQKALPANPVPGRRSLPRPGGASPLRPPGAGPQQSRPLAALAPK Predict reactive species\nFull Name: ADAM metallopeptidase domain 19 (meltrin beta)\nCalculated Molecular Weight: 955 aa, 105 kDa\nObserved Molecular Weight: 105 kDa\nGenBank Accession Number: BC024214\nGene Symbol: ADAM19\nGene ID (NCBI): 8728\nRRID: AB_2879034\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H013\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869631631529,"sku":"22216-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22216-1-ap","provider":"Iright","version":"1.0","type":"link"}