{"product_id":"proteintech-22232-1-ap","title":"Proteintech, 22232-1-AP, KIRREL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KIRREL (22232-1-AP) by Proteintech is a Polyclonal antibody targeting KIRREL in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n22232-1-AP targets KIRREL in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C2C12 cells, mouse brain tissue,  mouse kidney tissue,  mouse lung tissue,  rat brain tissue\nPositive IF-P detected in: mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKin of IRRE protein (KIRREL), also known as NEPH1, is a member of a podocin-binding protein family. KIRREL is a component of the podocyte slit diaphragm, which serves as the structural framework of the glomerular filtration barrier. KIRREL has three isoforms with molecular weights of 85 kDa, 83 kDa, and 72 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17578 Product name: Recombinant human KIRREL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 607-757 aa of BC109192 Sequence: NVRAHEDRPSSRAVLYADYRAPGPARFDGRPSSRLSHSSGYAQLNTYSRGPASDYGPEPTPPGPAAPAGTDTTSQLSYENYEKFNSHPFPGAAGYPTYRLGYPQAPPSGLERTPYEAYDPIGKYATATRFSYTSQHSDYGQRFQQRMQTHV Predict reactive species\nFull Name: kin of IRRE like (Drosophila)\nCalculated Molecular Weight: 757 aa, 84 kDa\nObserved Molecular Weight: 72 kDa\nGenBank Accession Number: BC109192\nGene Symbol: KIRREL\nGene ID (NCBI): 55243\nRRID: AB_3085689\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96J84\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887697252521,"sku":"22232-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22232-1-ap","provider":"Iright","version":"1.0","type":"link"}