{"product_id":"proteintech-22240-1-ap","title":"Proteintech, 22240-1-AP, TLR6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TLR6 (22240-1-AP) by Proteintech is a Polyclonal antibody targeting TLR6 in WB, ELISA applications with reactivity to human, mouse, rat samples\n22240-1-AP targets TLR6 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RAW 264.7 cells, HT-1080 cells,  human brain tissue,  Jurkat cells,  mouse thymus tissue,  rat thymus tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTLR6, also known as CD286, belongs to the Toll-like receptor (TLR) family, which is important in the innate immune response to pathogens. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. TLR6 can form a heterodimer with TLR2. TLR6 and TLR2 are recruited to the macrophage phagosome, where they recognize peptidoglycan, a Gram-positive pathogen component (PMID: 11095740). TLR6 interacts with CD36, following CD36 stimulation by oxLDL or amyloid-beta 42, and forms a heterodimer with TLR4. The trimeric complex is internalized and triggers an inflammatory response.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17686 Product name: Recombinant human TLR6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 143-383 aa of BC111755 Sequence: GNLSQLNFLGLSAMKLQKLDLLPIAHLHLSYILLDLRNYYIKENETESLQILNAKTLHLVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIKFLSELTRGPTLLNFTLNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHITNQVFLFSQTALYTVFSEMNIMMLTISDTPFIHMLCPHAPSTFKFLNFTQNVFTDSIFEKCSTLVKLETLI Predict reactive species\nFull Name: toll-like receptor 6\nCalculated Molecular Weight: 480 aa, 56 kDa\nObserved Molecular Weight: 95-110 kDa\nGenBank Accession Number: BC111755\nGene Symbol: TLR6\nGene ID (NCBI): 10333\nRRID: AB_11232032\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2C9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868915028137,"sku":"22240-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22240-1-ap","provider":"Iright","version":"1.0","type":"link"}