{"product_id":"proteintech-22249-1-ap","title":"Proteintech, 22249-1-AP, RBM15B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RBM15B (22249-1-AP) by Proteintech is a Polyclonal antibody targeting RBM15B in WB, IP, ELISA applications with reactivity to human,  mouse,  rat samples\n22249-1-AP targets RBM15B in WB, IHC, IP, CoIP, RIP, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HEK-293 cells,  mouse brain tissue\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRBM15B, one members of the SPEN (Split-end) family of proteins, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components. Present polyclonal anti-RBM15B antibody was produced by immunizing animals with C-terminus of RBM15B, which homolog with a short form of RBM15B(563aa, ~70kDa), thus this antibody can recognize full length of RBM15B(~100kDa) and splice-one(70kDa)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17744 Product name: Recombinant human RBM15B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 490-769 aa of BC001367 Sequence: AKAEETRYPQQYQPSPLPVHYELLTDGYTRHRNLDADLVRDRTPPHLLYSDRDRTFLEGDWTSPSKSSDRRNSLEGYSRSVRSRSGERWGADGDRGLPKPWEERRKRRSLSSDRGRTTHSPYEERSRTKGSGQQSERGSDRTPERSRKENHSSEGTKESSSNSLSNSRHGAEERGHHHHHHEAADSSHGKKARDSERNHRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVISSLLKDHTSGSKLTQLKIAQRL Predict reactive species\nFull Name: RNA binding motif protein 15B\nCalculated Molecular Weight: 890 aa, 97 kDa\nObserved Molecular Weight: 100-120 kDa, 70 kDa\nGenBank Accession Number: BC001367\nGene Symbol: RBM15B\nGene ID (NCBI): 29890\nRRID: AB_2879048\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NDT2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868908015785,"sku":"22249-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22249-1-ap","provider":"Iright","version":"1.0","type":"link"}