{"product_id":"proteintech-22258-1-ap","title":"Proteintech, 22258-1-AP, ASF1B-specific Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ASF1B-specific (22258-1-AP) by Proteintech is a Polyclonal antibody targeting ASF1B-specific in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n22258-1-AP targets ASF1B-specific in WB, IHC, IF\/ICC, ChIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HEK-293 cells,  HeLa cells\nPositive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nASF1B is a member of the H3\/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.  This antibody specifically reacts with the 19kd ASF1B protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17763 Product name: Recombinant human ASF1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 151-202 aa of BC010014 Sequence: INWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI Predict reactive species\nFull Name: ASF1 anti-silencing function 1 homolog B (S. cerevisiae)\nCalculated Molecular Weight: 202 aa, 22 kDa\nObserved Molecular Weight: 20-22 kDa\nGenBank Accession Number: BC010014\nGene Symbol: ASF1B\nGene ID (NCBI): 55723\nRRID: AB_2879051\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NVP2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868962836649,"sku":"22258-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22258-1-ap","provider":"Iright","version":"1.0","type":"link"}