{"product_id":"proteintech-22342-1-ap","title":"Proteintech, 22342-1-AP, CCL17\/TARC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCL17\/TARC (22342-1-AP) by Proteintech is a Polyclonal antibody targeting CCL17\/TARC in IHC, ELISA applications with reactivity to human samples\n22342-1-AP targets CCL17\/TARC in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human colon tissue, human placenta tissue,  human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCL17, also named as TARC, is a member of the CC chemokine family, and is highly expressed by thymus and other cells, including keratinocytes, endothelial cells, dendritic cells, bronchial epithelial cells and fibroblasts. CCL17 plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. CCL17 induced chemotaxis and Ca2+ influx in the cells stably expressing CCR4, thereby demonstrating the ligand-receptor relationship between CCL17 and CCR4.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17832 Product name: Recombinant human CCL17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-94 aa of BC112066 Sequence: AARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS Predict reactive species\nFull Name: chemokine (C-C motif) ligand 17\nCalculated Molecular Weight: 94 aa, 11 kDa\nGenBank Accession Number: BC112066\nGene Symbol: CCL17\nGene ID (NCBI): 6361\nRRID: AB_2879081\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92583\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869522251945,"sku":"22342-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22342-1-ap","provider":"Iright","version":"1.0","type":"link"}