{"product_id":"proteintech-22351-1-ap","title":"Proteintech, 22351-1-AP, CCR3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCR3 (22351-1-AP) by Proteintech is a Polyclonal antibody targeting CCR3 in IHC, ELISA applications with reactivity to human samples\n22351-1-AP targets CCR3 in IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human tonsillitis tissue,  human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:100-1:400\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17926 Product name: Recombinant human CCR3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 310-354 aa of BC110297 Sequence: KYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIV Predict reactive species\nFull Name: chemokine (C-C motif) receptor 3\nCalculated Molecular Weight: 355 aa, 41 kDa\nGenBank Accession Number: BC110297\nGene Symbol: CCR3\nGene ID (NCBI): 1232\nRRID: AB_2879085\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: P51677\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869398257833,"sku":"22351-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22351-1-ap","provider":"Iright","version":"1.0","type":"link"}