{"product_id":"proteintech-22371-1-ap","title":"Proteintech, 22371-1-AP, GYS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GYS2 (22371-1-AP) by Proteintech is a Polyclonal antibody targeting GYS2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n22371-1-AP targets GYS2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, mouse kidney tissue,  rat liver tissue\nPositive IP detected in: rat liver tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18012 Product name: Recombinant human GYS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 604-703 aa of BC126310 Sequence: YYQHARHLTLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN Predict reactive species\nFull Name: glycogen synthase 2 (liver)\nCalculated Molecular Weight: 703 aa, 81 kDa\nObserved Molecular Weight: 81 kDa\nGenBank Accession Number: BC126310\nGene Symbol: GYS2\nGene ID (NCBI): 2998\nRRID: AB_2879091\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P54840\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868897431721,"sku":"22371-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22371-1-ap","provider":"Iright","version":"1.0","type":"link"}