{"product_id":"proteintech-22419-1-ap","title":"Proteintech, 22419-1-AP, ADRA1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADRA1B (22419-1-AP) by Proteintech is a Polyclonal antibody targeting ADRA1B in WB, ELISA applications with reactivity to human, mouse, rat samples\n22419-1-AP targets ADRA1B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse heart tissue,  mouse testis tissue,  rat brain tissue\nPositive FC (Intra) detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18138 Product name: Recombinant human ADRA1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 381-520 aa of BC136569 Sequence: LGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLTEPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF Predict reactive species\nFull Name: adrenergic, alpha-1B-, receptor\nCalculated Molecular Weight: 520 aa, 57 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC136569\nGene Symbol: ADRA1B\nGene ID (NCBI): 147\nRRID: AB_2879103\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: P35368\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869391868073,"sku":"22419-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22419-1-ap","provider":"Iright","version":"1.0","type":"link"}