{"product_id":"proteintech-22456-1-ap","title":"Proteintech, 22456-1-AP, PKLR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PKLR (22456-1-AP) by Proteintech is a Polyclonal antibody targeting PKLR in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n22456-1-AP targets PKLR in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, 293 cell,  HEK-293 cells,  HeLa cells,  HepG2.MCF7 cells,  human kidney tissue,  human liver tissue,  MCF-7 cells,  mouse heart tissue,  mouse muscle\/liver tissue, ,  multi-cells\/tissue,  Raji cells\nPositive IHC detected in: human lung cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPKLR(Pyruvate kinase isozymes R\/L) is also named as PK1,PKL,which is a glycolytic enzyme that catalyzes the transphosphorylation from phosphoenolpyruvate (PEP) to ADP, yielding pyruvate and ATP. It is the last step of the glycolytic pathway and is essentially irreversible.It belongs to the pyruvate kinase family and There are 4 isozymes of pyruvate kinase in mammals: L, R, M1 and M2. L type is major isozyme in the liver, R is found in red cells, M1 is the main form in muscle, heart and brain, and M2 is found in early fetal tissues.Defects in PKLR are the cause of pyruvate kinase hyperactivity (PKHYP) and pyruvate kinase deficiency of red cells (PKRD).It can form a homotetramer(PMID:11960989).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17933 Product name: Recombinant human PKLR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 446-556 aa of BC025737 Sequence: PLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVT Predict reactive species\nFull Name: pyruvate kinase, liver and RBC\nCalculated Molecular Weight: 574 aa, 62 kDa\nObserved Molecular Weight: 58-62 kDa\nGenBank Accession Number: BC025737\nGene Symbol: PKLR\nGene ID (NCBI): 5313\nRRID: AB_10918271\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P30613\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868891238569,"sku":"22456-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22456-1-ap","provider":"Iright","version":"1.0","type":"link"}