{"product_id":"proteintech-22462-1-ap","title":"Proteintech, 22462-1-AP, GNRHR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNRHR (22462-1-AP) by Proteintech is a Polyclonal antibody targeting GNRHR in WB, IHC, ELISA applications with reactivity to human,  mouse, rat samples\n22462-1-AP targets GNRHR in WB, IHC, ELISA applications and shows reactivity with human,  mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse ovary tissue, mouse testis tissue\nPositive IHC detected in: human testis tissue, rat testis tissue,  mouse testis tissue,  human pituitary adenoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGNRHR, also named GRHR, belongs to the G-protein coupled receptor 1 family. GNRHR is a receptor for GnRH that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). It mediates its action by association with G-proteins that activate a phosphatidylinositol-calcium second messenger system. Isoform2 of GNRHR may act as an inhibitor of GnRH-R signaling. Defects in GNRHR are a cause of idiopathic hypogonadotropic hypogonadism (IHH). Defects in GNRHR are a cause of fertile eunuch syndrome. The antibody only recognizes the isoform1 of GNRHR. The predicted unmodified molecular weight of the human GNRHR is ~38 kDa, the larger band (50-65 kDa) is likely to represent a glycosylated form of GNRHR.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18005 Product name: Recombinant human GNRHR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 226-285 aa of BC113546 Sequence: IMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYV Predict reactive species\nFull Name: GnRH receptor\nCalculated Molecular Weight: 328 aa, 38 kDa\nObserved Molecular Weight: 60 kDa, 50 kDa\nGenBank Accession Number: BC113546\nGene Symbol: GNRHR\nGene ID (NCBI): 2798\nRRID: AB_2879109\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P30968\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869688352937,"sku":"22462-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22462-1-ap","provider":"Iright","version":"1.0","type":"link"}