{"product_id":"proteintech-22474-1-ap","title":"Proteintech, 22474-1-AP, FOXA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FOXA2 (22474-1-AP) by Proteintech is a Polyclonal antibody targeting FOXA2 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human samples\n22474-1-AP targets FOXA2 in WB, IHC, IF-P, IP, CoIP, chIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, HepG2 cells,  A549 cells,  MDA-MB-231 cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat stomach tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFOXA2 also named as HNF 3 beta or TCF3B is a 457 amino acid protein, which contains one fork-head DNA-binding domains. FOXA2 can Shuttle between the nucleus and cytoplasm in a CRM1-dependent manner. Phosphorylation on FOXA2 Thr-156 abolishes binding to target promoters and subsequent transcription activation upon INS stimulation. FOXA2 as a transcription factor involves in embryonic development, establishment of tissue-specific gene expression and regulation of gene expression in differentiated tissues. The molecular weight of FOXA2 is 48kDa, but the phosphorylated FOXA2 may be a 55-65kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18221 Product name: Recombinant human FOXA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of BC011780 Sequence: MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKP Predict reactive species\nFull Name: forkhead box A2\nCalculated Molecular Weight: 457 aa, 48 kDa\nObserved Molecular Weight: 55-65 kDa\nGenBank Accession Number: BC011780\nGene Symbol: FOXA2\nGene ID (NCBI): 3170\nRRID: AB_2879110\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y261\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868864598185,"sku":"22474-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22474-1-ap","provider":"Iright","version":"1.0","type":"link"}