{"product_id":"proteintech-22551-1-ap","title":"Proteintech, 22551-1-AP, RFX6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RFX6 (22551-1-AP) by Proteintech is a Polyclonal antibody targeting RFX6 in WB, ELISA applications with reactivity to human samples\n22551-1-AP targets RFX6 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe RFX proteins represent an essential class II transcription factor family that share several conserved regions, including a centrally located DNA-binding domain (DBD) and a C-terminal D region that facilitates dimerization. RFX6, also known as RFXDC1, is a 928 amino acid nuclear protein that, via interactions with other RFX proteins, can bind DNA and is thought to activate the transcription of target genes. RFX6 is specifically expressed in pancreas, small intestine and colon. Mutations in the gene encoding RFX6 is the cause of the Mitchell-Riley syndrome (MIRIS), which is characterized by neonatal diabetes, duodenal and jejunal atresia, a hypoplastic or annular pancreas and absent gallbladder.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18235 Product name: Recombinant human RFX6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 586-928 aa of BC039248 Sequence: SDAVKNESHVETTYLPLPSSQPGGLGPALHQFPAGNTDNMPLTGQMELSQIAGHLMTPPISPAMASRGSVINQGPMAGRPPSVGPVLSAPSHCSTYPEPIYPALPQANHDFYSTSSNYQTVFRAQPHSTSGLYPHHTEHGRCMAWTEQQLSRDFFSGSCAGSPYNSRPPSSYGPSLQAQDSHNMQFLNTGSFNFLSNTGAASCQGATLPPNSPNGYYGSNINYPESHRLGSMVNQHVSVISSIRSLPPYSDIHDPLNILDDSGRKQTSSFYTDTSSPVACRTPVLASSLQTPIPSSSSQCMYGTSNQYPAQETLDSHGTSSREMVSSLPPINTVFMGTAAGGT Predict reactive species\nFull Name: regulatory factor X, 6\nCalculated Molecular Weight: 928 aa, 102 kDa\nObserved Molecular Weight: 102 kDa\nGenBank Accession Number: BC039248\nGene Symbol: RFX6\nGene ID (NCBI): 222546\nRRID: AB_2879120\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8HWS3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869752479913,"sku":"22551-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22551-1-ap","provider":"Iright","version":"1.0","type":"link"}