{"product_id":"proteintech-22587-1-ap","title":"Proteintech, 22587-1-AP, WBP2NL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WBP2NL (22587-1-AP) by Proteintech is a Polyclonal antibody targeting WBP2NL in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n22587-1-AP targets WBP2NL in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue, mouse testis tissue\nPositive IHC detected in: mouse testis tissue, mouse ovary tissue,  rat epididymis tissue,  rat ovary tissue,  rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWBP2NL, also known as PAWP, is a protein found in the post-acrosomal region of mammalian spermatozoa. It was initially proposed as a sperm-borne oocyte-activating factor (SOAF) that triggers calcium oscillations essential for oocyte activation and embryo development. However, recent studies have shown mixed results regarding its role in fertilization. While some investigations suggest that PAWP can induce oocyte activation, others indicate that it may not be sufficient to compensate for the absence of other critical factors like PLCZ1. Additionally, altered WBP2NL expression has been observed in breast cancer tissues, hinting at its potential involvement in oncogenic regulation. (PMID: 24907910, PMID: 25417742, PMID: 28663133)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18347 Product name: Recombinant human WBP2NL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-309 aa of BC022546 Sequence: MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGTLFLTSYRVIFITSCSISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGGAIEFAQLMVKAASAAARGFPLRTLNDWFSSMGIYVITGEGNMCTPQMPCSVIVYGAPPAGYGAPPPGYGAPPAGYGAQPVGNEGPPVGYRASPVRYGAPPLGYGAPPAGYGAPPLGYGAPPLGYGTPPLGYGAPPLGYGAPPAGNEGPPAGYRASPAGSGARPHESTAAQAPENEASLPSASSSQVHS Predict reactive species\nFull Name: WBP2 N-terminal like\nCalculated Molecular Weight: 309 aa, 32 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC022546\nGene Symbol: WBP2NL\nGene ID (NCBI): 164684\nRRID: AB_2879128\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6ICG8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868938260649,"sku":"22587-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22587-1-ap","provider":"Iright","version":"1.0","type":"link"}