{"product_id":"proteintech-22592-1-ap","title":"Proteintech, 22592-1-AP, SORLA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SORLA (22592-1-AP) by Proteintech is a Polyclonal antibody targeting SORLA in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n22592-1-AP targets SORLA in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissue, human brain tissue,  rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSorLA also known as SorL1 or LR11, is a multiligand receptor belonging to the LDL receptor superfamily. It is also a member of vacuolar protein sorting-10 (Vps10) family and is enriched in the brain. SorLA acts as an sorting receptor for APP and prevents amyloidogenic processing of APP. Downregulation of SorLA has been found in patients with sporadic Alzheimer disease (AD). Currently SorLA has emerged as a potential target for AD therapy. (25404298)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18445 Product name: Recombinant human SORL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1865-2214 aa of BC137171 Sequence: PRNVVYGIFYATSFLDLYRNPKSLTTSLHNKTVIVSKDEQYLFLVRVVVPYQGPSSDYVVVKMIPDSRLPPRHLHVVHTGKTSVVIKWESPYDSPDQDLLYAIAVKDLIRKTDRSYKVKSRNSTVEYTLNKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVLLFWKSLALKEKHFNESRGYEIHMFDSAMNITAYLGNTTDNFFKISNLKMGHNYTFTVQARCLFGNQICGEPAILLYDELGSGADASATQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSFTAFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA Predict reactive species\nFull Name: sortilin-related receptor, L(DLR class) A repeats-containing\nCalculated Molecular Weight: 2214 aa, 248 kDa\nObserved Molecular Weight: 300 kDa\nGenBank Accession Number: BC137171\nGene Symbol: SORLA\nGene ID (NCBI): 6653\nRRID: AB_2879131\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q92673\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869385445545,"sku":"22592-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22592-1-ap","provider":"Iright","version":"1.0","type":"link"}