{"product_id":"proteintech-22605-1-ap","title":"Proteintech, 22605-1-AP, FNDC3B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FNDC3B (22605-1-AP) by Proteintech is a Polyclonal antibody targeting FNDC3B in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n22605-1-AP targets FNDC3B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 4T1 cells, HL-60 cells,  HepG2 cells,  C6 cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFibronectin type III domain-containing protein 3B(FNDC3B), also named FAD104, belongs to the FNDC3 family. NDC3B is a positive regulator of adipocyte differentiation and is expressed at an early stage of adipocyte differentiation. FNDC3B is an endoplasmic reticulum transmembrane protein with a single transmembrane domain at the C terminus preceded by nine repeated fibronectin type III domains(PMID: 32966780). Due to the ability of the fibronectin type III domain to bind to a variety of proteins, FNDC3B plays a crucial role in cell adhesion, proliferation, and growth signaling. FNDC3B is abnormally expressed in a variety of human cancers, including hepatocellular carcinoma, acute myeloid leukemia, colorectal carcinoma, and cervical carcinoma(PMID: 36275754).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18357 Product name: Recombinant human FNDC3B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 3-370 aa of BC039297 Sequence: VTMMMTDQIPLELPPLLNGEVAMMPHLVNGDAAQQVILVQVNPGETFTIRAEDGTLQCIQGPAEVPMMSPNGSIPPIHVPPGYISQVIEDSTGVRRVVVTPQSPECYPPSYPSAMSPTHHLPPYLTHHPHFIHNSHTAYYPPVTGPGDMPPQFFPQHHLPHTIYGEQEIIPFYGMSSYITREDQYSKPPHKKLKDRQIDRQNRLNSPPSSIYKSSCTTVYNGYGKGHSGGSGGGGSGSGPGIKKTERRARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPPVGLSCGPHSGLSFPYSYEVALSDKGRDGKYKIIYSGEELECNLKDLRPATDYHVRVYAMYNSVKGSCSEPV Predict reactive species\nFull Name: fibronectin type III domain containing 3B\nCalculated Molecular Weight: 1204 aa, 133 kDa\nObserved Molecular Weight: 150 kDa, 70 kDa\nGenBank Accession Number: BC039297\nGene Symbol: FNDC3B\nGene ID (NCBI): 64778\nRRID: AB_2879133\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q53EP0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868941177001,"sku":"22605-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22605-1-ap","provider":"Iright","version":"1.0","type":"link"}