{"product_id":"proteintech-22649-1-ap","title":"Proteintech, 22649-1-AP, AKIRIN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AKIRIN1 (22649-1-AP) by Proteintech is a Polyclonal antibody targeting AKIRIN1 in IP, ELISA applications with reactivity to human samples\n22649-1-AP targets AKIRIN1 in IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAkirin1 is a highly conserved ubiquitously expressed nuclear protein harboring a clear nuclear localization signal and the protein-protein interaction property. Acting as a cofactor, Akirin1 has been disclosed that regulate transcriptional activities by establishing a link between multiple transcription factors and chromatin remodeling complexes (PMID: 39188701) . Akirin1 has been shown to be involved in the induction of cardiac hypertrophy via miR-1 and serum response factor (SRF) in mice (PMID: 30746755).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18530 Product name: Recombinant human AKIRIN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC119745 Sequence: MACGATLKRPMEFEAALLSPGSPKRRRCAPLPGPTPGLRPPDAEPPPPFQTQTPPQSLQQPAPPGSERRLPTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAPSSPGSSWMKKDQ Predict reactive species\nFull Name: akirin 1\nCalculated Molecular Weight: 192 aa, 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC119745\nGene Symbol: AKIRIN1\nGene ID (NCBI): 79647\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H9L7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869806448809,"sku":"22649-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22649-1-ap","provider":"Iright","version":"1.0","type":"link"}