{"product_id":"proteintech-22666-1-ap","title":"Proteintech, 22666-1-AP, HES5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HES5 (22666-1-AP) by Proteintech is a Polyclonal antibody targeting HES5 in WB, IHC, ELISA applications with reactivity to human,  mouse,  rat samples\n22666-1-AP targets HES5 in WB, IHC, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHES5, also known as bHLHb38, has a particular type of basic domain (presence of a helix-interrupting proline) that binds to the N-box (CACNAG), rather than the canonical E-box (CANNTG). HES5 is expressed in fetal heart and brain tumors. HES5 as a transcriptional repressor of genes that require a bHLH protein for their transcription and plays an important role as neurogenesis negative regulator. HES5 is detected with molecular weight of 41 kDa according to the publication (PMID: 24286475).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, mink\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18270 Product name: Recombinant human HES5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC087840 Sequence: MRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKGERARAPRAPSSHRAPAPPRPAARSPPPRLPAAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPW Predict reactive species\nFull Name: hairy and enhancer of split 5 (Drosophila)\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 41 kDa\nGenBank Accession Number: BC087840\nGene Symbol: HES5\nGene ID (NCBI): 388585\nRRID: AB_2879147\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5TA89\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868902281385,"sku":"22666-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22666-1-ap","provider":"Iright","version":"1.0","type":"link"}