{"product_id":"proteintech-22691-1-ap","title":"Proteintech, 22691-1-AP, ZBTB17 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZBTB17 (22691-1-AP) by Proteintech is a Polyclonal antibody targeting ZBTB17 in WB, ELISA applications with reactivity to human, mouse samples\n22691-1-AP targets ZBTB17 in  applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, THP-1 cells,  NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZBTB17 (zinc finger and BTB domain protein 17), also known as MIZ1, is a highly conserved transcription factor in evolution. It is expressed in many cell types and plays an important role in many biological processes such as cell cycle regulation, immune cell development and metabolic regulation. ZBTB17 plays a key role in the early stage of T cell development. It ensures the normal development of T cells by regulating the expression of pre-TCR and inhibiting the activity of TP53. ZBTB17 plays an important role in cardiac stress response, and its absence may lead to cardiomyopathy and heart failure. At Lys-397 and Lys-481, it undergoes \"Lys-48\" linked ubiquitination, and then degrades proteasome in a TRAF2-dependent manner.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18396 Product name: Recombinant human ZBTB17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 454-803 aa of BC126163 Sequence: KFNQVGNLKAHLKIHIADGPLKCRECGKQFTTSGNLKRHLRIHSGEKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLSKHIIIHTGEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGSEVSVVTVDDMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGGTWPAGQVLQAGELVFRPRDGAEGQPALAETSPTAPECPPPAE Predict reactive species\nFull Name: zinc finger and BTB domain containing 17\nCalculated Molecular Weight: 803 aa, 88 kDa\nObserved Molecular Weight: 88-100 kDa\nGenBank Accession Number: BC126163\nGene Symbol: ZBTB17\nGene ID (NCBI): 7709\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q13105\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887926661289,"sku":"22691-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22691-1-ap","provider":"Iright","version":"1.0","type":"link"}