{"product_id":"proteintech-22726-1-ap","title":"Proteintech, 22726-1-AP, SLC26A4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC26A4 (22726-1-AP) by Proteintech is a Polyclonal antibody targeting SLC26A4 in WB, IHC, IP, ELISA applications with reactivity to human samples\n22726-1-AP targets SLC26A4 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 37°C incubated A549 cells\nPositive IP detected in: mouse kidney tissue\nPositive IHC detected in: mouse kidney tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18622 Product name: Recombinant human SLC26A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 517-646 aa of BC153002 Sequence: SWNGLGSIPSTDIYKSTKNYKNIEEPQGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKSGQLRATKNGIISDAVSTNNAFEPDEDIEDLEELDIPTKEIEIQVDWNSELPV Predict reactive species\nFull Name: solute carrier family 26, member 4\nCalculated Molecular Weight: 780 aa, 86 kDa\nObserved Molecular Weight: 90 kDa\nGenBank Accession Number: BC153002\nGene Symbol: SLC26A4\nGene ID (NCBI): 5172\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43511\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887805354153,"sku":"22726-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22726-1-ap","provider":"Iright","version":"1.0","type":"link"}