{"product_id":"proteintech-22765-1-ap","title":"Proteintech, 22765-1-AP, SPRY4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPRY4 (22765-1-AP) by Proteintech is a Polyclonal antibody targeting SPRY4 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n22765-1-AP targets SPRY4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPRY4, also named as Protein sprouty homolog 4, is a 299 amino acid protein, which contains one SPR (sprouty) domain and belongs to the sprouty family. SPRY4 Suppresses the INS receptor and EGFR-transduced MAPK signaling pathway, but does not inhibit MAPK activation by a constitutively active mutant Ras. Probably impairs the formation of GTP-Ras. SPRY4 has a cellular function to regulate the actin cytoskeleton, independent of its inhibitory activity on the Ras\/MAP kinase signalling. SPRY1, SPRY2, SPRY3, SPRY4, are central and complex regulators of the receptor tyrosine kinase (RTK) signalling pathway.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18574 Product name: Recombinant human SPRY4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC125095 Sequence: MEPPIPQSAPLTPNSVMVQPLLDSRMSHSRLQHPLTILPIDQVKTSHVENDYIDNPSLALTTGPKRTRGGAPELAPTPARCDQDVTHHWISFSGRPSSVSSSSSTSSDQRLLDHMAPPPVADQASPRAVRIQPKVVHCQPLDLKGPAVPPELDKHFLLCEACGKC Predict reactive species\nFull Name: sprouty homolog 4 (Drosophila)\nCalculated Molecular Weight: 299 aa, 33 kDa\nObserved Molecular Weight: 35-38 kDa\nGenBank Accession Number: BC125095\nGene Symbol: SPRY4\nGene ID (NCBI): 81848\nRRID: AB_2879163\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9C004\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868989837481,"sku":"22765-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22765-1-ap","provider":"Iright","version":"1.0","type":"link"}