{"product_id":"proteintech-22842-1-ap","title":"Proteintech, 22842-1-AP, NO66\/C14orf169 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NO66\/C14orf169 (22842-1-AP) by Proteintech is a Polyclonal antibody targeting NO66\/C14orf169 in WB, IP, ELISA applications with reactivity to human samples\n22842-1-AP targets NO66\/C14orf169 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, Jurkat cells,  NCCIT cells\nPositive IP detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNO66, also known as C14orf169 and MAPJD, is a JmjC domain-containing oxygenase that can act as both a histone lysine demethylase and a ribosomal histidine hydroxylase. NO66 is highly conserved during evolution and shows a dual localization pattern, present in both the nucleoplasm and nucleolus (PMID: 14742713). It has been reported that NO66 participates in regulation of Osx transcriptional activity and plays an important role in osteoblast differentiation through interaction with Osx (PMID: 19927124; 23620590). Through interaction with MYC protein, NO66 plays a role in pulmonary carcinogenesis (PMID: 17308053).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18721 Product name: Recombinant human C14orf169 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 296-640 aa of BC011350 Sequence: LRLLCPQAFSTTVWQFLAVLQEQFGSMAGSNVYLTPPNSQGFAPHYDDIEAFVLQLEGRKLWRVYRPRAPTEELALTSSPNFSQDDLGEPVLQTVLEPGDLLYFPRGFIHQAECQDGVHSLHLTLSTYQRNTWGDFLEAILPLAVQAAMEENVEFRRGLPRDFMDYMGAQHSDSKDPRRTAFMEKVRVLVARLGHFAPVDAVADQRAKDFIHDSLPPVLTDRERALSVYGLPIRWEAGEPVNVGAQLTTETEVHMLQDGIARLVGEGGHLFLYYTVENSRVYHLEEPKCLEIYPQQADAMELLLGSYPEFVRVGDLPCDSVEDQLSLATTLYDKGLLLTKMPLAL Predict reactive species\nFull Name: chromosome 14 open reading frame 169\nCalculated Molecular Weight: 641 aa, 71 kDa\nObserved Molecular Weight: 71 kDa\nGenBank Accession Number: BC011350\nGene Symbol: NO66\nGene ID (NCBI): 79697\nRRID: AB_2879175\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q9H6W3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887739523241,"sku":"22842-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22842-1-ap","provider":"Iright","version":"1.0","type":"link"}