{"product_id":"proteintech-22879-1-ap","title":"Proteintech, 22879-1-AP, B3GNT7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe B3GNT7 (22879-1-AP) by Proteintech is a Polyclonal antibody targeting B3GNT7 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n22879-1-AP targets B3GNT7 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells,  COLO 320 cells,  mouse placenta tissue\nPositive IHC detected in: human colon cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:100-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nB3GNT7, the glycosyltransferase gene that was most significantly upregulated by IL-22 treatment, encodes an N-acetylglucosaminyltransferase involved in the biosynthesis of polyLacNAc repeats of keratan sulfate (PMID: 34864058). B3GNT7 was initially identified in 2002 and is notable for high expression in healthy intestinal epithelial cells (PMID: 38886669). Overexpressed B3GNT7 were correlated with poor prognosis in breast cancer patients based on public datasets. B3GNT7 was shown to be a potential biomarker for unfavorable outcomes and therapeutic target of breast cancer (PMID: 37740763).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18890 Product name: Recombinant human B3GNT7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 31-164 aa of BC148680 Sequence: PGQFLQEPPPPTLEPQKAQKPNGQLVNPNNFWKNPKDVAAPTPMASQGPQAWDVTTTNCSANINLTHQPWFQVLEPQFRQFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGRERQSA Predict reactive species\nFull Name: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7\nCalculated Molecular Weight: 330 aa, 37 kDa\nObserved Molecular Weight: 40-46 kDa\nGenBank Accession Number: BC148680\nGene Symbol: B3GNT7\nGene ID (NCBI): 93010\nRRID: AB_2879182\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NFL0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885170577577,"sku":"22879-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22879-1-ap","provider":"Iright","version":"1.0","type":"link"}