{"product_id":"proteintech-22936-1-ap","title":"Proteintech, 22936-1-AP, ACOT6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ACOT6 (22936-1-AP) by Proteintech is a Polyclonal antibody targeting ACOT6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n22936-1-AP targets ACOT6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue,  HeLa cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18981 Product name: Recombinant human ACOT6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 37-126 aa of BC126380 Sequence: TVLINACVANTVAPLHYKDMIIPKLVDDLGKVKITKSGFLTFMDTWSNPLEEHNHQSLVPLEKAQVPFLFIVGMDDQSWKSEFYAQIASE Predict reactive species\nFull Name: acyl-CoA thioesterase 6\nCalculated Molecular Weight: 207 aa, 23 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC126380\nGene Symbol: ACOT6\nGene ID (NCBI): 641372\nRRID: AB_11182380\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q3I5F7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869800452265,"sku":"22936-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-22936-1-ap","provider":"Iright","version":"1.0","type":"link"}