{"product_id":"proteintech-23045-1-ap","title":"Proteintech, 23045-1-AP, OXTR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OXTR (23045-1-AP) by Proteintech is a Polyclonal antibody targeting OXTR in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n23045-1-AP targets OXTR in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HeLa cells,  L02 cells\nPositive IP detected in: L02 cells\nPositive IHC detected in: mouse placenta tissue, human breast cancer tissue,  human hysteromyoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOxytocin (OXT) is a neurohypophysial hormone that plays a role in lactation and parturition and in the central nervous system as a neurotransmitter involved in sex and maternal behavior (PMID: 1852313; 10811917). OXT acts through its receptor, OXTR, which belongs to the G protein-coupled 7-transmembrane receptor family. OXTR is expressed in the endometrium, myometrium, and mammary gland (PMID: 1313946). This antibody is raised against the C-terminal region of human OXTR. Two immunoreactive OXTR bands were found in the fat tissue, an unglycosylated 43 kDa form and a mature glycosylated 67 kDa form (PMID:32819381).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19074 Product name: Recombinant human OXTR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 327-389 aa of BC137443 Sequence: WIYMLFTGHLFHELVQRFLCCSASYLKGRRLGETSASKKSNSSSFVLSHRSSSQRSCSQPSTA Predict reactive species\nFull Name: OXTR\nCalculated Molecular Weight: 389 aa, 43 kDa\nObserved Molecular Weight: 46 kDa, 67 kDa\nGenBank Accession Number: BC137443\nGene Symbol: OXTR\nGene ID (NCBI): 5021\nRRID: AB_2827425\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P30559\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868868235433,"sku":"23045-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23045-1-ap","provider":"Iright","version":"1.0","type":"link"}