{"product_id":"proteintech-23073-1-ap","title":"Proteintech, 23073-1-AP, SUPT6H Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SUPT6H (23073-1-AP) by Proteintech is a Polyclonal antibody targeting SUPT6H in WB, IHC, IP, ELISA applications with reactivity to human samples\n23073-1-AP targets SUPT6H in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HEK-293 cells,  Jurkat cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSUPT6H (suppressor of Ty6 homolog), also known as SPT6, SPT6H, Tat-CT2 (Tat-cotransactivator 2 protein) or emb-5 in C. elegans, is a 1,726 amino acid protein that is highly conserved from yeast to humans. Expressed ubiquitously, SUPT6H localizes to the nucleus and contains one SH2 domain and one S1 domain. SUPT6H participates in both DRB (5,6-dichloro-1-beta-D-ribofuranosylbenzimidazole)-mediated transcriptional inhibition as well as the enhancement of transcriptional elongation by the RNA polymerase II (Pol II). SUPT6H interacts with the nuclear proteins SPT4 and SPT5, which comprise the DSIF (DRB-sensitivity-inducing factor) complex that binds RNA polymerase II, and directly regulates elongation. Via its C-terminus, SUPT6H can also interact with Histone H3. Due to alternative splicing events, three isoforms exist for SUPT6H. This antibody specifically recognizes the 230kd phosphorylated SUPT6H protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19426 Product name: Recombinant human SUPT6H protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1618-1726 aa of BC136524 Sequence: TPSYSYTTPSQPITTPQYHQLQASTTPQSAQAQPQPSSSSRQRQQQPKSNSHAAIDWGKMAEQWLQEKEAERRKQKQRLTPRPSPSPMIESTPMSIAGDATPLLDEMDR Predict reactive species\nFull Name: suppressor of Ty 6 homolog (S. cerevisiae)\nCalculated Molecular Weight: 1726 aa, 199 kDa\nObserved Molecular Weight: 230 kDa\nGenBank Accession Number: BC136524\nGene Symbol: SUPT6H\nGene ID (NCBI): 6830\nRRID: AB_11232593\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7KZ85\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869609840809,"sku":"23073-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23073-1-ap","provider":"Iright","version":"1.0","type":"link"}