{"product_id":"proteintech-23079-1-ap","title":"Proteintech, 23079-1-AP, CD99 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD99 (23079-1-AP) by Proteintech is a Polyclonal antibody targeting CD99 in WB, IHC, ELISA applications with reactivity to human samples\n23079-1-AP targets CD99 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, U-937 cells,  THP-1 cells\nPositive IHC detected in: human pancreas tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD99, also known as MIC2, is a heavily O-glycosylated transmembrane protein involved in T-cell adhesion processes and in spontaneous rosette formation with erythrocytes. CD99 is broadly distributed on many cell types, with particularly strong expression on human cortical thymocytes, Ewing's sarcoma cells and peripheral primitive neuroectodermal tumors (PMID: 9794396; 16984917). In normal cells, CD99 has been functionally implicated in cell adhesion, migration, apoptosis, differentiation, activation, and proliferation of lymphocytes and monocyte extravasation and transport of several transmembrane proteins (PMID: 16984917). CD99 displays two surface isoforms generated by alternative splicing: a long 32 kDa and a short 28 kDa form (PMID: 12368226).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19461 Product name: Recombinant human CD99 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-115 aa of BC021620 Sequence: LSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHR Predict reactive species\nFull Name: CD99 molecule\nCalculated Molecular Weight: 19 kDa, 16 kDa, 17 kDa\nObserved Molecular Weight: 28 kDa, 32 kDa\nGenBank Accession Number: BC021620\nGene Symbol: CD99\nGene ID (NCBI): 4267\nRRID: AB_2879205\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: P14209\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869451800745,"sku":"23079-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23079-1-ap","provider":"Iright","version":"1.0","type":"link"}