{"product_id":"proteintech-23140-1-ap","title":"Proteintech, 23140-1-AP, REEP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe REEP3 (23140-1-AP) by Proteintech is a Polyclonal antibody targeting REEP3 in WB, ELISA applications with reactivity to human samples\n23140-1-AP targets REEP3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, L02 cells,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nREEP3 (Receptor Expression-Enhancing Protein 3) is a member of the REEP family of proteins, a transmembrane protein that interacts with odorant receptor proteins and may enhance the odorant receptor responses to odorants. It primarily regulates the tubular morphology of the endoplasmic reticulum by promoting high membrane curvature through its reticular homology domains. During mitosis, REEP3 binds to microtubules, separating the endoplasmic reticulum from chromosomes to ensure proper nuclear membrane remodeling and cell division.(PMID: 23911198; 30995177)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19400 Product name: Recombinant human REEP3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 73-255 aa of BC068557 Sequence: VIWLLSPYTKGASLIYRKFLHPLLSSKEREIDDYIVQAKERGYETMVNFGRQGLNLAATAAVTAAVKSQGAITERLRSFSMHDLTTIQGDEPVGQRPYQPLPEAKKKSKPAPSESAGYGIPLKDGDEKTDEEAEGPYSDNEMLTHKGLRRSQSMKSVKTTKGRKEVRYGSLKYKVKKRPQVYF Predict reactive species\nFull Name: receptor accessory protein 3\nCalculated Molecular Weight: 255 aa, 29 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC068557\nGene Symbol: REEP3\nGene ID (NCBI): 221035\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6NUK4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887781957801,"sku":"23140-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23140-1-ap","provider":"Iright","version":"1.0","type":"link"}