{"product_id":"proteintech-23142-1-ap","title":"Proteintech, 23142-1-AP, TMEM127 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM127 (23142-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM127 in IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n23142-1-AP targets TMEM127 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human stomach cancer tissue, human heart tissue,  human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19472 Product name: Recombinant human TMEM127 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 139-238 aa of BC039892 Sequence: QCATVIGFSYWASELILAQQQQHKKYHGSQVYVTFAVSFYLVAGAGGASILATAANLLRHYPTEEEEQALELLSEMEENEPYPAEYEVINQFQPPPAYTP Predict reactive species\nFull Name: transmembrane protein 127\nCalculated Molecular Weight: 238 aa, 26 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC039892\nGene Symbol: TMEM127\nGene ID (NCBI): 55654\nRRID: AB_2879217\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: O75204\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869617049769,"sku":"23142-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23142-1-ap","provider":"Iright","version":"1.0","type":"link"}