{"product_id":"proteintech-23172-1-ap","title":"Proteintech, 23172-1-AP, ERVWE1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ERVWE1 (23172-1-AP) by Proteintech is a Polyclonal antibody targeting ERVWE1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n23172-1-AP targets ERVWE1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nERVWE1 encodes a 538 amino-acid, 73-kDa glycosylated (60 kDa unglycosylated) envelope protein, Syncytin-1. It is expressed in the placental syncytiotrophoblast and participates in syncytium formation during placenta morphogenesis. Mounting evidence suggests that aberrant expression of ERVWE1 involves the etiology of schizophrenia.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19227 Product name: Recombinant human ERVWE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 274-371 aa of BC137381 Sequence: TSAYRCLNGSSESMCFLSFLVPPMTIYTEQDLYSYVISKPRNKRVPILPFVIGAGVLGALGTGIGGITTSTQFYYKLSQELNGDMERVADSLVTLQDQ Predict reactive species\nFull Name: endogenous retroviral family W, env(C7), member 1\nCalculated Molecular Weight: 538 aa, 60 kDa\nObserved Molecular Weight: 70-73 kDa\nGenBank Accession Number: BC137381\nGene Symbol: ERVWE1\nGene ID (NCBI): 30816\nRRID: AB_3085707\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UQF0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869679964329,"sku":"23172-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23172-1-ap","provider":"Iright","version":"1.0","type":"link"}