{"product_id":"proteintech-23226-1-ap","title":"Proteintech, 23226-1-AP, ATG2A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATG2A (23226-1-AP) by Proteintech is a Polyclonal antibody targeting ATG2A in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n23226-1-AP targets ATG2A in WB, IHC, IF\/ICC, IP, CoIP, ELISA, Peptide array applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, MCF-7 cells,  Raji cells\nPositive IP detected in: K-562 cells\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAutophagy-related protein 2 homolog A (ATG2A) belongs to the ATG2 family. ATG2A is a lipid transfer protein involved in autophagosome assembly (PMID:31271352). ATG2A tethers the edge of the isolation membrane (IM) to the endoplasmic reticulum (ER) and mediates direct lipid transfer from ER to IM for IM expansion. ATG2A binds to the ER exit site (ERES), which is the membrane source for autophagosome formation, and extracts phospholipids from the membrane source and transfers them to ATG9 (ATG9A or ATG9B) to the IM for membrane expansion (PMID: 30952800, PMID: 31271352). ATG2A also regulates lipid droplet morphology and distribution within the cell (PMID: 28561066). The observed MW of ATG2A is 215 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19709 Product name: Recombinant human ATG2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 194-539 aa of BC110650 Sequence: RVQRLEYCDEAVRDPSQAPPVDVHQPPAFLHKLLQLAGVRLHYEELPAQEEPPEPPLQIGSCSGYMELMVKLKQNEAFPGPKLEVAGQLGSLHLLLTPRQLQQLQELLSAVSLTDHEGLADKLNKSRPLGAEDLWLIEQDLNQQLQAGAVAEPLSPDPLTNPLLNLDNTDLFFSMAGLTSSVASALSELSLSDVDLASSVRSDMASRRLSAQAHPAGKMAPNPLLDTMRPDSLLKMTLGGVTLTLLQTSAPSSGPPDLATHFFTEFDATKDGPFGSRDFHHLRPRFQRACPCSHVRLTGTAVQLSWELRTGSRGRRTTSMEVHFGQLEVLECLWPRGTSEPEYTEI Predict reactive species\nFull Name: ATG2 autophagy related 2 homolog A (S. cerevisiae)\nCalculated Molecular Weight: 1938 aa, 213 kDa\nObserved Molecular Weight: 215 kDa\nGenBank Accession Number: BC110650\nGene Symbol: ATG2A\nGene ID (NCBI): 23130\nRRID: AB_2879235\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q2TAZ0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868910178473,"sku":"23226-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23226-1-ap","provider":"Iright","version":"1.0","type":"link"}