{"product_id":"proteintech-23277-1-ap","title":"Proteintech, 23277-1-AP, Trefoil factor 3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Trefoil factor 3 (23277-1-AP) by Proteintech is a Polyclonal antibody targeting Trefoil factor 3 in IHC, ELISA applications with reactivity to human samples\n23277-1-AP targets Trefoil factor 3 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human colon tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTrefoil factor 3 (TFF3) belongs to the TFF-domain peptide family which consists of three small secreted proteins (TFF1, TFF2, TFF3) that are expressed by mucous-secreting epithelia. TFF3 is a major constituent in the goblet cells in small and large intestines, especially a typical secretary peptide of the normal human antral and pyloric gastric mucosa. TFF3 is essential in regulating cell migration and maintaining normal GI mucosal integrity. TFF3 has been reported to be overexpressed at the gene and the protein level in human neoplasms such as prostate, breast, and colon cancer. TFF3 is involved in tumor cell scattering, angiogenesis, and invasion.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9543 Product name: Recombinant human TFF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC017859 Sequence: MAARALCMLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF Predict reactive species\nFull Name: trefoil factor 3 (intestinal)\nCalculated Molecular Weight: 80 aa, 9 kDa\nGenBank Accession Number: BC017859\nGene Symbol: TFF3\nGene ID (NCBI): 7033\nRRID: AB_2879245\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q07654\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869388591273,"sku":"23277-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23277-1-ap","provider":"Iright","version":"1.0","type":"link"}