{"product_id":"proteintech-23288-1-ap","title":"Proteintech, 23288-1-AP, TRIF\/TICAM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRIF\/TICAM1 (23288-1-AP) by Proteintech is a Polyclonal antibody targeting TRIF\/TICAM1 in WB, IHC, ELISA applications with reactivity to human samples\n23288-1-AP targets TRIF\/TICAM1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MOLT-4 cells, Ramos cells,  Raji cells\nPositive IHC detected in: human brain tissue, human testis tissue,  human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRIF (adaptor-induced interferon-β containing the tir domain) is a key adapter protein in Toll-like receptor signaling, mediating the MyD88-independent pathway of TLR3 and TLR4. It activates NF-κB and interferon regulator 3 (IRF3), leading to the production of type I interferon and pro-inflammatory cytokines. TRIF recruits TRAF3 to activate TBK1\/IKKε kinases and interacts with RIPK1, playing a crucial dual role in antiviral and inflammatory innate immune responses.(PMID: 12855817; 14519765; 28469251)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19779 Product name: Recombinant human TICAM1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-200 aa of BC035331 Sequence: LDEHSQIFARKVANTFKPHRLQARKAMWRKEQDTRALREQSQHLDGERMQAAALNAAYSAYLQSYLSYQAQMEQLQVAFGSHMSFGTGAPYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE Predict reactive species\nFull Name: toll-like receptor adaptor molecule 1\nCalculated Molecular Weight: 712 aa, 76 kDa\nObserved Molecular Weight: 66-76 kDa\nGenBank Accession Number: BC035331\nGene Symbol: TRIF\nGene ID (NCBI): 148022\nRRID: AB_2879247\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IUC6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868868628649,"sku":"23288-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23288-1-ap","provider":"Iright","version":"1.0","type":"link"}