{"product_id":"proteintech-23309-1-ap","title":"Proteintech, 23309-1-AP, IDH1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IDH1 (23309-1-AP) by Proteintech is a Polyclonal antibody targeting IDH1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n23309-1-AP targets IDH1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, mouse liver tissue\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIDH1, also named as PICD and IDP, belongs to the isocitrate and isopropylmalate dehydrogenases family. It is a common feature of a major subset of primary human brain cancers. Its subunit structure is homodimer(PMID:15173171).IDH1 mutation is always heterozygotic and IDH1 functions as a dimer, theoretically there will be 25% each wild type and mutant homo-dimers and 50% hetero-dimers present in the tumor cells(PMID:21079649 ). This antibody is specific to IDH1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19749 Product name: Recombinant human IDH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 341-414 aa of BC012846 Sequence: AHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL Predict reactive species\nFull Name: isocitrate dehydrogenase 1 (NADP+), soluble\nCalculated Molecular Weight: 414 aa, 47 kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: BC012846\nGene Symbol: IDH1\nGene ID (NCBI): 3417\nRRID: AB_11232028\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75874\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869466218665,"sku":"23309-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23309-1-ap","provider":"Iright","version":"1.0","type":"link"}