{"product_id":"proteintech-23326-1-ap","title":"Proteintech, 23326-1-AP, GPR39 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPR39 (23326-1-AP) by Proteintech is a Polyclonal antibody targeting GPR39 in IHC, ELISA applications with reactivity to human samples\n23326-1-AP targets GPR39 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPR39 (G protein-coupled receptor 39), a member of the ghrelin family of G protein-coupled receptors, is zinc-responsive and contributes to the regulation of diverse neurovascular and neurologic functions (PMID: 34360964). GPR39 has relatively high ligand-independent constitutive activity, based on an aromatic cluster on the inner face of the extracellular ends of TM domains VI and VII, similar to other members of the ghrelin receptor family (PMID: 33918078).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19913 Product name: Recombinant human GPR39 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 336-453 aa of BC125046 Sequence: SSVINPLLYTVSSQQFRRVFVQVLCCRLSLQHANHEKRLRVHAHSTTDSARFVQRPLLFASRRQSSARRTEKIFLSTFQSEAEPQSKSQSLSLESLEPNSGAKPANSAAENGFQEHEV Predict reactive species\nFull Name: G protein-coupled receptor 39\nCalculated Molecular Weight: 453 aa, 51 kDa\nGenBank Accession Number: BC125046\nGene Symbol: GPR39\nGene ID (NCBI): 2863\nRRID: AB_2879255\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43194\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869546270889,"sku":"23326-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23326-1-ap","provider":"Iright","version":"1.0","type":"link"}