{"product_id":"proteintech-23345-1-ap","title":"Proteintech, 23345-1-AP, KDELC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KDELC2 (23345-1-AP) by Proteintech is a Polyclonal antibody targeting KDELC2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n23345-1-AP targets KDELC2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  human placenta tissue,  SMMC-7721 cells\nPositive IHC detected in: human breast cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19929 Product name: Recombinant human KDELC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-343 aa of BC036526 Sequence: VNGTPSPIPIISWCGSLDSRDVVLPTYDITHSMLEAMRGVTNDLLSIQGNTGPSWINKTERAFFRGRDSLEERLQLVQLSKENPQLLDAGITGY Predict reactive species\nFull Name: KDEL (Lys-Asp-Glu-Leu) containing 2\nCalculated Molecular Weight: 507 aa, 59 kDa\nObserved Molecular Weight: 62 kDa\nGenBank Accession Number: BC036526\nGene Symbol: KDELC2\nGene ID (NCBI): 143888\nRRID: AB_2879260\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z4H8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887693385897,"sku":"23345-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23345-1-ap","provider":"Iright","version":"1.0","type":"link"}