{"product_id":"proteintech-23351-1-ap","title":"Proteintech, 23351-1-AP, AMOTL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AMOTL2 (23351-1-AP) by Proteintech is a Polyclonal antibody targeting AMOTL2 in WB, IP, ELISA applications with reactivity to human samples\n23351-1-AP targets AMOTL2 in WB, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IP detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAngiomotin‑like 2 (AMOTL2) is a member of the motin family of angiostatin‑binding proteins. The motin family, also known as AMOTs, consists of three members: AMOT, AMOT-like 1 (AMOTL1) and AMOTL2. Members of the motin family are a type of adaptor proteins mainly distributed in the cytomembrane, cytoplasm or nucleus, and have a higher expression in the endothelial cells of capillaries and in larger vessels of the placenta. Human AmotL2 encodes two isoforms of a molecular mass of 100 kDa and 60 kDa.(PMID: 34036399,PMID: 25080976)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19953 Product name: Recombinant human AMOTL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 340-466 aa of BC011454 Sequence: DPGKAIQGSLRPAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLTTDRAPTEEPVVTAPPAAHAKHGSRDGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQRAASLDSVATSRVQDLSDMVEILI Predict reactive species\nFull Name: angiomotin like 2\nCalculated Molecular Weight: 779 aa, 86 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC011454\nGene Symbol: AMOTL2\nGene ID (NCBI): 51421\nRRID: AB_2879263\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2J4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868922532009,"sku":"23351-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23351-1-ap","provider":"Iright","version":"1.0","type":"link"}