{"product_id":"proteintech-23355-1-ap","title":"Proteintech, 23355-1-AP, FOLR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FOLR1 (23355-1-AP) by Proteintech is a Polyclonal antibody targeting FOLR1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n23355-1-AP targets FOLR1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, JAR cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFolate receptor 1 (FOLR1), also known as folate receptor alpha or adult folate-binding protein (FBP), is a 38-kDa glycoprotein belonging to the folate receptor family (PMID:15094207; 23528302). The receptor binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. FOLR1 is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. FOLR1 expression is often limited to the apical surfaces of epithelium in the lung, kidney and choroid plexus but is differentially overexpressed in a variety of solid tumors such as ovarian cancer, non-small cell lung cancer, breast cancer, kidney cancer and high-grade osteosarcoma (PMID: 23528302; 23357463).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, camelus bactrianus\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19959 Product name: Recombinant human FOLR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 55-93 aa of BC002947 Sequence: EQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMA Predict reactive species\nFull Name: folate receptor 1 (adult)\nCalculated Molecular Weight: 257 aa, 30 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC002947\nGene Symbol: FOLR1\nGene ID (NCBI): 2348\nRRID: AB_2879264\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P15328\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868897235113,"sku":"23355-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-23355-1-ap","provider":"Iright","version":"1.0","type":"link"}